PDB entry 4k8j

View 4k8j on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease mutant V23L/V66I
Class: hydrolase
Keywords: DNA hydrolase, RNA hydrolase, endonuclease, hydrolase
Deposited on 2013-04-18, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-134)
      • engineered mutation (16)
      • engineered mutation (59)
    Domains in SCOPe 2.07: d4k8ja_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k8jA (A:)
    lhkepatlikaidgdtlklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkmi
    enakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlr
    kseaqakkeklniws