PDB entry 4k7p

View 4k7p on RCSB PDB site
Description: Generation and Characterization of a Unique Reagent that Recognizes a Panel of Recombinant Human Monoclonal Antibody Therapeutics in the Presence of Endogenous Human IgG
Class: immune system
Keywords: immunoglobulin, IMMUNE SYSTEM
Deposited on 2013-04-17, released 2013-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 10C4 Fab fragment heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K7P (0-End)
  • Chain 'L':
    Compound: antibody 10C4 Fab fragment light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K7P (0-213)
    Domains in SCOPe 2.07: d4k7pl1, d4k7pl2
  • Chain 'X':
    Compound: antibody rhumAb6 Fab fragment light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K7P (0-212)
    Domains in SCOPe 2.07: d4k7px1, d4k7px2
  • Chain 'Y':
    Compound: antibody rhumAb6 Fab fragment heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K7P (0-End)

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k7pL (L:)
    diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
    rfsgsgsgtqfslkinnlqpedfgsyycqhhyvtpvtfgagtkldlkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k7pX (X:)
    diqmtqspsslsasvgdrvtitcrasssvsylhwyqqkpgkapkpliyapsnlasgvpsr
    fsgsgsgtdftltisslqpedfatyycqqwafnpptfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'Y':
    No sequence available.