PDB entry 4k6r

View 4k6r on RCSB PDB site
Description: Crystal structure of GlmU in complex with ATP
Class: Transferase
Keywords: Rossmann Fold, Transferase
Deposited on 2013-04-16, released 2014-04-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-06-18, with a file datestamp of 2014-06-13.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: 0.16
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional protein glmU
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: glmU, MT1046, Rv1018c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4k6ra1, d4k6ra2
  • Heterogens: ATP, MG, GN1, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k6rA (A:)
    hhhhhhmtfpgdtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrliv
    vlghdhqriaplvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgd
    tplldadtladliathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsq
    reirevnagvyafdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsal
    vagvnnrvqlaelaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllg
    rtqiggrcvvgpdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgk
    lgafvevknstigtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrt
    gsdtmfvapvtigdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas
    krasemacqqptqppdadqtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k6rA (A:)
    dtavlvlaagpgtrmrsdtpkvlhtlagrsmlshvlhaiaklapqrlivvlghdhqriap
    lvgeladtlgrtidvalqdrplgtghavlcglsalpddyagnvvvtsgdtplldadtlad
    liathravsaavtvltttlddpfgygrilrtqdhevmaiveqtdatpsqreirevnagvy
    afdiaalrsalsrlssnnaqqelyltdviailrsdgqtvhashvddsalvagvnnrvqla
    elaselnrrvvaahqlagvtvvdpattwidvdvtigrdtvihpgtqllgrtqiggrcvvg
    pdttltdvavgdgasvvrthgssssigdgaavgpftylrpgtalgadgklgafvevknst
    igtgtkvphltyvgdadigeysnigassvfvnydgtskrrttvgshvrtgsdtmfvapvt
    igdgaytgagtvvredvppgalavsagpqrnienwvqrkrpgspaaqas