PDB entry 4k6l

View 4k6l on RCSB PDB site
Description: Structure of Typhoid Toxin
Class: toxin
Keywords: complex, bacterial toxin, sugar, TOXIN
Deposited on 2013-04-16, released 2013-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1891, t1107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A3 (0-113)
• Chain 'B':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1891, t1107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A3 (0-113)
• Chain 'C':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1891, t1107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A3 (0-113)
• Chain 'D':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1891, t1107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A3 (0-113)
• Chain 'E':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1891, t1107
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A3 (0-113)
• Chain 'F':
  Compound: Cytolethal distending toxin subunit B homolog
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: cdtB, STY1886, t1111
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A7 (0-246)
  Domains in SCOPe 2.07: d4k6lf_
• Chain 'G':
  Compound: Putative pertussis-like toxin subunit
  Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:90370]
  Gene: STY1890, t1108
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8Z6A4 (0-223)
  Domains in SCOPe 2.07: d4k6lg_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >4k6lF (F:)
  nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq
  pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva
  srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr
  lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv
  aflarsclehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4k6lF (F:)
  nisdykvmtwnlqgssasteskwnvnvrqllsgtagvdilmvqeagavptsavptgrhiq
  pfgvgipideytwnlgttsrqdiryiyhsaidvgarrvnlaivsrqradnvyvlrpttva
  srpvigiglgndvfltahalasggpdaaaivrvtinffrqpqmrhlswflagdfnrspdr
  lendlmtehlervvavlapteptqigggildygvivdrapysqrvealrnpqlasdhypv
  aflarsc
  

  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k6lG (G:)
  vdfvyrvdstppdvifrdgfsllgynrnfqqfisgrscsggssdsryiattssvnqtyai
  arayysrstfkgnlyryqiradnnfysllpsityletqgghfnayektmmrlqreyvstl
  silpeniqkavalvydsatglvkdgvstmnasylglsttsnpgvipflpepqtytqqrid
  afgplisscfsigsvchshrgqradvynmsfydarpvielilsk