PDB entry 4k6f

View 4k6f on RCSB PDB site
Description: X-ray crystal structure of a putative Acetoacetyl-CoA reductase from Burkholderia cenocepacia bound to the co-factor NADP
Class: oxidoreductase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, Acetoacetyl-CoA reductase, oxidoreductase
Deposited on 2013-04-15, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-15, with a file datestamp of 2013-05-10.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.168
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Acetoacetyl-CoA reductase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: phbB, BceJ2315_08230, BCAL0833
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k6fa_
  • Chain 'B':
    Compound: Putative Acetoacetyl-CoA reductase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: phbB, BceJ2315_08230, BCAL0833
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k6fb_
  • Chain 'C':
    Compound: Putative Acetoacetyl-CoA reductase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: phbB, BceJ2315_08230, BCAL0833
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k6fc_
  • Chain 'D':
    Compound: Putative Acetoacetyl-CoA reductase
    Species: BURKHOLDERIA CENOCEPACIA [TaxId:216591]
    Gene: phbB, BceJ2315_08230, BCAL0833
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k6fd_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k6fA (A:)
    mahhhhhhmtkriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaag
    refhaypvdvadhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtn
    ldsvfnmtkpvcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleia
    rkgvtvntvspgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagf
    vtgsniainggqhmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k6fA (A:)
    kriavvtggmgglgeavsirlndaghrvvvtyspadrwltemhaagrefhaypvdvadhd
    scqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkpvcdg
    mvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvspgyl
    atkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniainggqhm
    h
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k6fB (B:)
    mahhhhhhmtkriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaag
    refhaypvdvadhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtn
    ldsvfnmtkpvcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleia
    rkgvtvntvspgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagf
    vtgsniainggqhmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k6fB (B:)
    kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv
    adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp
    vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs
    pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing
    gqhmh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k6fC (C:)
    mahhhhhhmtkriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaag
    refhaypvdvadhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtn
    ldsvfnmtkpvcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleia
    rkgvtvntvspgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagf
    vtgsniainggqhmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k6fC (C:)
    kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv
    adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp
    vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs
    pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing
    gqhmh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k6fD (D:)
    mahhhhhhmtkriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaag
    refhaypvdvadhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtn
    ldsvfnmtkpvcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleia
    rkgvtvntvspgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagf
    vtgsniainggqhmh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k6fD (D:)
    kriavvtggmgglgeavsirlndaghrvvvtyspnntgadrwltemhaagrefhaypvdv
    adhdscqqciekivrdvgpvdilvnnagitrdmtlrkldkvnwdavirtnldsvfnmtkp
    vcdgmvergwgrivnissvngskgsvgqtnyaaakagmhgftkslaleiarkgvtvntvs
    pgylatkmvtaipqdildtkilpqipagrlgkpeevaalvaylcseeagfvtgsniaing
    gqhmh