PDB entry 4k67

View 4k67 on RCSB PDB site
Description: Structure of an airborne transmissible avian influenza H5 hemagglutinin mutant from the influenza virus A/Indonesia/5/2005 complexed with human receptor analog LSTc
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-04-15, released 2013-05-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.229
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
      • engineered mutation (103)
      • engineered mutation (156)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.03: d4k67a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
      • engineered mutation (103)
      • engineered mutation (156)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.03: d4k67c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
      • engineered mutation (103)
      • engineered mutation (156)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.03: d4k67e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
      • engineered mutation (103)
      • engineered mutation (156)
      • engineered mutation (222)
      • engineered mutation (224)
    Domains in SCOPe 2.03: d4k67g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k67A (A:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k67C (C:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k67E (E:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k67G (G:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'H':
    No sequence available.