PDB entry 4k64

View 4k64 on RCSB PDB site
Description: Structure of an avian influenza H5 hemagglutinin from the influenza virus complexed with human receptor analog LSTc
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-04-15, released 2013-05-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-05-29, with a file datestamp of 2013-05-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.224
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
    Domains in SCOPe 2.06: d4k64a1, d4k64a2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k64b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
    Domains in SCOPe 2.06: d4k64c1, d4k64c2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k64d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
    Domains in SCOPe 2.06: d4k64e1, d4k64e2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k64f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8HWY8 (1-320)
      • expression tag (0)
    Domains in SCOPe 2.06: d4k64g1, d4k64g2
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:400788]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4k64h_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64A (A:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64B (B:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64C (C:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64D (D:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64E (E:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64F (F:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64G (G:)
    qdqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvag
    wllgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipk
    sswsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgih
    hpndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndai
    nfesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihplti
    gecpkyvksnrlvlatglrns
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k64H (H:)
    glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
    tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
    kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse