PDB entry 4k5c

View 4k5c on RCSB PDB site
Description: From DARPins to LoopDARPins: Novel LoopDARPin Design Allows the Selection of Low Picomolar Binders in a Single Round of Ribosome Display
Class: structural protein
Keywords: structural protein
Deposited on 2013-04-14, released 2013-11-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.173
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Loop Designed Ankyrin Repeat Protein Nran1_G06_C
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K5C
    Domains in SCOPe 2.04: d4k5ca_
  • Chain 'B':
    Compound: Loop Designed Ankyrin Repeat Protein Nran1_G06_C
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K5C (Start-182)
    Domains in SCOPe 2.04: d4k5cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k5cA (A:)
    mrgshhhhhhgsdlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghl
    eivevllktgadvnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadv
    nafadlghtplhlaaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlq
    kaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k5cA (A:)
    dlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghleivevllktgad
    vnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadvnafadlghtplh
    laaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlqka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k5cB (B:)
    mrgshhhhhhgsdlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghl
    eivevllktgadvnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadv
    nafadlghtplhlaaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlq
    kaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k5cB (B:)
    dlgkklleaawqgqddevrilmangadvnaqdkfgttplhlaadmghleivevllktgad
    vnaaatghyfqpyfshsvsyfgetplhlaaemghleivevllkagadvnafadlghtplh
    laaqwghleivevllkhgadvnaqdkfgktpfdlaidngnediaevlqkaa