PDB entry 4k55

View 4k55 on RCSB PDB site
Description: Structure of the extracellular domain of butyrophilin BTN3A1 in complex with (E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate (HMBPP)
Class: signaling protein
Keywords: immunoglobulin superfamily, SIGNALING PROTEIN
Deposited on 2013-04-13, released 2013-07-24
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Butyrophilin subfamily 3 member A1
    Species: Homo sapiens [TaxId:9606]
    Gene: BT3.2, BTF3, BTF4, BTF5, BTN3A1, BTN3A2, Butyrophilin subfamily 3 member A1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00481 (Start-115)
      • expression tag (116-119)
    Domains in SCOPe 2.03: d4k55a_
  • Heterogens: H6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4k55A (A:)
saqfsvlgpsgpilamvgedadlpchlfptmsaetmelkwvssslrqvvnvyadgkeved
rqsapyrgrtsilrdgitagkaalrihnvtasdsgkylcyfqdgdfyekalvelkvlehh
hhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4k55A (A:)
qfsvlgpsgpilamvgedadlpchlfptmsaetmelkwvssslrqvvnvyadgkevedrq
sapyrgrtsilrdgitagkaalrihnvtasdsgkylcyfqdgdfyekalvelkvlehh