PDB entry 4k4o

View 4k4o on RCSB PDB site
Description: The DNA Gyrase B ATP binding domain of Enterococcus faecalis in complex with a small molecule inhibitor
Class: isomerase/isomerase inhibitor
Keywords: ATP-binding, Nucleotide-binding, Topoisomerase, ATP-binding domain, Isomerase-Isomerase inhibitor complex, cytosol
Deposited on 2013-04-12, released 2014-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-15, with a file datestamp of 2014-01-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.179
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA gyrase subunit b
    Species: Enterococcus faecalis [TaxId:226185]
    Gene: EF_0005, gyrB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q839Z1 (0-206)
      • expression tag (207-209)
    Domains in SCOPe 2.08: d4k4oa1, d4k4oa2
  • Heterogens: DOO, TBU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k4oA (A:)
    gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
    rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
    kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
    flnrglhisiedrregqedkkeyhyeglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k4oA (A:)
    gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
    rgipvgiqaktgrpavetvftvlgssvvnalstsldvrvykdgkvyyqeyrrgavvddlk
    vieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregqedk
    keyhyegleh