PDB entry 4k4i

View 4k4i on RCSB PDB site
Description: Ternary crystal structures of a human DNA POLYMERASE LAMBDA IN COMPLEX WITH DNA AND (-)FTC-TP.
Class: transferase/DNA
Keywords: DNA POLYMERASE, DNA REPAIR, PHOSPHORYL TRANSFER REACTION, TRANSFERASE-DNA complex
Deposited on 2013-04-12, released 2014-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.215
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-331)
      • expression tag (332-338)
    Domains in SCOPe 2.07: d4k4ia1, d4k4ia2, d4k4ia3, d4k4ia4
  • Chain 'B':
    Compound: DNA (5'-d(*cp*gp*gp*cp*gp*gp*tp*ap*cp*tp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
  • Chain 'D':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
  • Chain 'E':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-331)
      • expression tag (332-333)
    Domains in SCOPe 2.07: d4k4ie1, d4k4ie2, d4k4ie3, d4k4ie4
  • Chain 'F':
    Compound: DNA (5'-d(*cp*gp*gp*cp*gp*gp*tp*ap*cp*tp*g)-3')
  • Chain 'G':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
  • Chain 'H':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
  • Chain 'I':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-331)
      • expression tag (332-336)
    Domains in SCOPe 2.07: d4k4ii1, d4k4ii2, d4k4ii3, d4k4ii4
  • Chain 'J':
    Compound: DNA (5'-d(*cp*gp*gp*cp*gp*gp*tp*ap*cp*tp*g)-3')
  • Chain 'K':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
  • Chain 'L':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
  • Chain 'M':
    Compound: DNA polymerase lambda
    Species: Homo sapiens [TaxId:9606]
    Gene: POLL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UGP5 (Start-331)
      • expression tag (332-333)
    Domains in SCOPe 2.07: d4k4im1, d4k4im2, d4k4im3, d4k4im4
  • Chain 'N':
    Compound: DNA (5'-d(*cp*gp*gp*cp*gp*gp*tp*ap*cp*tp*g)-3')
  • Chain 'O':
    Compound: DNA (5'-d(*cp*ap*gp*tp*ap*c)-3')
  • Chain 'P':
    Compound: DNA (5'-d(p*gp*cp*cp*g)-3')
  • Heterogens: 1RY, CA, ACT, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k4iA (A:)
    mssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsip
    gigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledi
    rsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgka
    tcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpg
    rrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgc
    kvgpgrvlptptekdvfrllglpyrepaerdwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k4iA (A:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpgr
    vlptptekdvfrllglpyrepaerdwlehhhhh
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k4iE (E:)
    mssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsip
    gigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledi
    rsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgka
    tcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpg
    rrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgc
    kvgpgrvlptptekdvfrllglpyrepaerdwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k4iE (E:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdwle
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4k4iI (I:)
    mssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsip
    gigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledi
    rsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgka
    tcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpg
    rrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgc
    kvgpgrvlptptekdvfrllglpyrepaerdwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k4iI (I:)
    tnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrm
    aekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqasl
    ttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvd
    vlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrrl
    diivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrntpgrvlptpt
    ekdvfrllglpyrepaerdwlehhh
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4k4iM (M:)
    mssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsip
    gigkrmaekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledi
    rsqaslttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgka
    tcgdvdvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpg
    rrhrrldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgc
    kvgpgrvlptptekdvfrllglpyrepaerdwlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k4iM (M:)
    atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
    maekiieilesghlrkldhisesvpvlelfsniwgagtktaqmwyqqgfrsledirsqas
    lttqqaiglkhysdflermpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdv
    dvlithpdgrshrgifsrlldslrqegfltddlvsqeengqqqkylgvcrlpgpgrrhrr
    ldiivvpysefacallyftgsahfnrsmralaktkgmslsehalstavvrnthgckvgpg
    rvlptptekdvfrllglpyrepaerdwle
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.