PDB entry 4k3y

View 4k3y on RCSB PDB site
Description: Crystal structure of a subtype N11 neuraminidase-like protein of A/flat-faced bat/Peru/033/2010 (H18N11)
Class: viral protein
Keywords: influenza virus, neuraminidase-like, N11, beta propeller, VIRAL PROTEIN
Deposited on 2013-04-11, released 2013-10-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.18
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3Y (Start-368)
    Domains in SCOPe 2.05: d4k3ya_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3Y (Start-368)
    Domains in SCOPe 2.05: d4k3yb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3Y (Start-368)
    Domains in SCOPe 2.05: d4k3yc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3Y (Start-368)
    Domains in SCOPe 2.05: d4k3yd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k3yA (A:)
    gspsratplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsm
    gygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdg
    fvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngt
    sagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgfl
    gdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsv
    qtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtg
    gsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3yA (A:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgyvse
    qmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsilyggiitdtih
    ptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwkaldttgfnfe
    fptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycdk
    tttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsnst
    igrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpdvnwg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k3yB (B:)
    gspsratplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsm
    gygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdg
    fvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngt
    sagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgfl
    gdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsv
    qtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtg
    gsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3yB (B:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgyvse
    qmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsilyggiitdtih
    ptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwkaldttgfnfe
    fptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycdk
    tttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsnst
    igrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpdvnwg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k3yC (C:)
    gspsratplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsm
    gygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdg
    fvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngt
    sagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgfl
    gdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsv
    qtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtg
    gsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3yC (C:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgygvs
    eqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsilyggiitdti
    hptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwkaldttgfnf
    efptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycd
    ktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsns
    tigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpdvnwg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k3yD (D:)
    gspsratplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsm
    gygtttnfadlivseqmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdg
    fvsilyggiitdtihptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngt
    sagwkaldttgfnfefptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgfl
    gdtprgidttnycdktttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsv
    qtvgnrnyqllsnstigrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtg
    gsmpdvnwg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3yD (D:)
    atplvlgenlcsingwvptyrgegttgkipdeqmltrqnfvscsdkecrrffvsmgyvse
    qmnvysvklgdpptpdklkfeavgwsasschdgfqwtvlsvagdgfvsilyggiitdtih
    ptnggplrtqasscicndgtcytiiadgttytasshrlyrlvngtsagwkaldttgfnfe
    fptcyytsgkvkctgtnlwndakrpflefdqsftytfkepclgflgdtprgidttnycdk
    tttegeggiqgfmiegsnswigriinpgskkgfeiykflgtlfsvqtvgnrnyqllsnst
    igrsglyqpayesrdcqelcfwieiaattkaglssndlitfcgtggsmpdvnwg