PDB entry 4k3x

View 4k3x on RCSB PDB site
Description: Crystal structure of a subtype H18 hemagglutinin homologue from A/flat-faced bat/Peru/033/2010 (H18N11)
Class: viral protein
Keywords: influenza virus, hemagglutinin homologue, H18, ectodomain, VIRAL PROTEIN
Deposited on 2013-04-11, released 2013-10-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.185
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xa_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xe_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3X
    Domains in SCOPe 2.04: d4k3xf_
  • Heterogens: P4G, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k3xA (A:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xA (A:)
    dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw
    lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt
    rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts
    naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv
    stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd
    cpkyvkaqelvlatglrnnpik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k3xB (B:)
    glfgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmn
    tqfestakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyq
    kvkvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xB (B:)
    iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
    takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
    lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkids
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k3xC (C:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xC (C:)
    dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw
    lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt
    rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts
    naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv
    stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd
    cpkyvkaqelvlatglrnnpik
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4k3xD (D:)
    glfgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmn
    tqfestakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyq
    kvkvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xD (D:)
    iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
    takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
    lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkids
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k3xE (E:)
    adpgdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcs
    lpawlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkeki
    idmtrfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgv
    hqtsnaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqn
    fsivstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqn
    aigdcpkyvkaqelvlatglrnnpiketr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xE (E:)
    dqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpaw
    lmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidmt
    rfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqts
    naaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsiv
    stgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaigd
    cpkyvkaqelvlatglrnnpik
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4k3xF (F:)
    glfgaiagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmn
    tqfestakefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyq
    kvkvqlkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkidsgrlvp
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3xF (F:)
    iagfieggwqglidgwygyhhqnsegsgyaadkeatqkavdaittkvnniidkmntqfes
    takefnkiemrikhlsdrvddgfldvwsynaellvllenertldfhdanvnnlyqkvkvq
    lkdnaidmgngcfkilhkcnntcmddikngtynyyeyrkeshlekqkids