PDB entry 4k3i

View 4k3i on RCSB PDB site
Description: Crystal Structure of the Quinol Form of Methylamine Dehydrogenase in Complex with the Diferrous Form of MauG, C2 Space Group
Class: oxidoreductase
Keywords: Oxidoreductase
Deposited on 2013-04-10, released 2013-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.146
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Methylamine utilization protein MauG
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: mauG, Pden_4736
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k3ic_
  • Chain 'D':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Methylamine dehydrogenase light chain
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k3ie_
  • Chain 'F':
    Compound: Methylamine dehydrogenase heavy chain
    Species: Paracoccus denitrificans [TaxId:318586]
    Gene: Pden_4730
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HEC, NA, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4k3iC (C:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3iC (C:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4k3iE (E:)
    adapagtdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvas
    cynptdgqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyh
    ctispivgkashhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3iE (E:)
    tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklatasxvascynptd
    gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
    vgkas
    

  • Chain 'F':
    No sequence available.