PDB entry 4k3e

View 4k3e on RCSB PDB site
Description: Crystal structure of bovine antibody BLV5B8 with ultralong CDR H3
Class: immune system
Keywords: IMMUNOGLOBULIN; CYSTINE KNOT, IMMUNE RECOGNITION, immune system
Deposited on 2013-04-10, released 2013-06-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-03, with a file datestamp of 2013-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.204
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: bovine antibody with ultralong cdr h3, heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene: IGH
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3E
  • Chain 'I':
    Compound: bovine antibody with ultralong cdr h3, heavy chain
    Species: Bos taurus [TaxId:9913]
    Gene: IGH
    Database cross-references and differences (RAF-indexed):
    • PDB 4K3E (0-End)
  • Chain 'L':
    Compound: bovine antibody with ultralong cdr h3, light chain
    Species: Bos taurus [TaxId:9913]
    Gene: IGL, IGL@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3T101 (1-215)
      • see remark 999 (4)
      • see remark 999 (80)
    Domains in SCOPe 2.04: d4k3el1, d4k3el2
  • Chain 'M':
    Compound: bovine antibody with ultralong cdr h3, light chain
    Species: Bos taurus [TaxId:9913]
    Gene: IGL, IGL@
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3T101
      • see remark 999 (4)
      • see remark 999 (80)
    Domains in SCOPe 2.04: d4k3em1, d4k3em2
  • Heterogens: TLA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4k3eL (L:)
    eavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4k3eM (M:)
    eavlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvp
    drfsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvt
    lfppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaass
    ylsltssdwkskgsyscevthegstvtktvkpsecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k3eM (M:)
    vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
    fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlgqpksppsvtlf
    ppsteelngnkatlvclisdfypgsvtvvwkadgstitrnvettraskqsnskyaassyl
    sltssdwkskgsyscevthegstvtktvkpsec