PDB entry 4k33

View 4k33 on RCSB PDB site
Description: Crystal Strucure of FGF Receptor 3 (FGFR3) Kinase Domain Harboring the K650E Mutation, a Gain-of-Function Mutation Responsible for Thanatophoric Dysplasia Type II and Spermatocytic Seminoma
Class: transferase
Keywords: Kinase Domain Fold Consisting of N- and C-lobes, Receptor Tyrosine Kinase, TRANSFERASE
Deposited on 2013-04-10, released 2013-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.181
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 3
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR3, JTK4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22607
      • engineered mutation (47)
      • engineered mutation (147)
      • engineered mutation (215)
    Domains in SCOPe 2.04: d4k33a_
  • Heterogens: ACP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k33A (A:)
    mgsshhhhhhsqdpptlanvselelpadpkwelsrarltlgkplgegafgqvvmaeaigi
    dkdraakpvtvavkmlkddatdkdlsdlvsememmkmigkhkniinllgactqggplyvl
    veyaakgnlreflrarrppgldysfdtskppeeqltfkdlvscayqvargmeylasqkci
    hrdlaarnvlvtednvmkiadfglardvhnldyykettngrlpvkwmapealfdrvythq
    sdvwsfgvllweiftlggspypgipveelfkllkeghrmdkpancthdlymimrecwhaa
    psqrptfkqlvedldrvltvtstde
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k33A (A:)
    lpadpkwelsrarltlgkplgegafgqvvmaeaigidkdraakpvtvavkmlkddatdkd
    lsdlvsememmkmigkhkniinllgactqggplyvlveyaakgnlreflrarrppgldys
    fdtseqltfkdlvscayqvargmeylasqkcihrdlaarnvlvtednvmkiadfglardv
    hnldyykettngrlpvkwmapealfdrvythqsdvwsfgvllweiftlggspypgipvee
    lfkllkeghrmdkpancthdlymimrecwhaapsqrptfkqlvedldrvltvt