PDB entry 4k1g

View 4k1g on RCSB PDB site
Description: Structure of E. coli Nfo(Endo IV)-H69A mutant bound to a cleaved DNA duplex containing a alphadA:T basepair
Class: hydrolase/DNA
Keywords: DNA endonuclease IV, HYDROLASE-DNA complex
Deposited on 2013-04-05, released 2013-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endonuclease 4
    Species: Escherichia coli [TaxId:83333]
    Gene: nfo, b2159, JW2146
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6C1 (0-End)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d4k1ga_
  • Chain 'B':
    Compound: Endonuclease 4
    Species: Escherichia coli [TaxId:83333]
    Gene: nfo, b2159, JW2146
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6C1 (0-End)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d4k1gb_
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*gp*tp*cp*c)-3')
  • Chain 'F':
    Compound: DNA (5'-d(*cp*gp*tp*cp*gp*tp*cp*gp*tp*gp*gp*ap*cp*gp*c)-3')
  • Chain 'H':
    Compound: DNA (5'-d(p*ap*cp*gp*ap*cp*gp*ap*cp*g)-3')
  • Chain 'M':
    Compound: DNA (5'-d(*gp*cp*gp*tp*cp*c)-3')
  • Chain 'N':
    Compound: DNA (5'-d(*cp*gp*tp*cp*gp*tp*cp*gp*tp*gp*gp*ap*cp*gp*c)-3')
  • Chain 'O':
    Compound: DNA (5'-d(p*ap*cp*gp*ap*cp*gp*ap*cp*g)-3')
  • Heterogens: ZN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k1gA (A:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqtekava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k1gA (A:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqteka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4k1gB (B:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgipliletinpdiwaeeiawlkaqqtekava
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k1gB (B:)
    mkyigahvsaagglanaairaaeidatafalftknqrqwraaplttqtidefkaacekyh
    ytsaqilpadsylinlghpvtealeksrdafidemqrceqlglsllnfhpgshlmqisee
    dclariaesinialdktqgvtavientagqgsnlgfkfehlaaiidgvedksrvgvcidt
    chafaagydlrtpaecektfadfartvgfkylrgmhlndakstfgsrvdrhhslgegnig
    hdafrwimqddrfdgipliletinpdiwaeeiawlkaqq
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.