PDB entry 4k18

View 4k18 on RCSB PDB site
Description: Structure of PIM-1 kinase bound to 5-(4-cyanobenzyl)-N-(4-fluorophenyl)-7-hydroxypyrazolo[1,5-a]pyrimidine-3-carboxamide
Class: transferase/transferase inhibitor
Keywords: PIM-1, kinase domain, Ser/Thr kinase, ATP-competitive, structure-based drug design, phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-04-04, released 2013-05-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Serine/threonine-protein kinase pim-1
  Species: Homo sapiens [TaxId:9606]
  Gene: PIM-1, PIM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11309 (0-276)
  Domains in SCOPe 2.05: d4k18a_
• Heterogens: PO4, 1OB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4k18A (A:)
  eplesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevv
  llkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqv
  leavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppe
  wiryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcl
  alrpsdrptfeeiqnhpwmqdvllpqetaeihlhsls