PDB entry 4k14

View 4k14 on RCSB PDB site
Description: Crystal Structure of Staphylococcal nuclease mutant V66I/V99L
Class: Hydrolase
Keywords: Hydrolase
Deposited on 2013-04-04, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.21
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644 (0-135)
      • engineered mutation (60)
      • engineered mutation (93)
    Domains in SCOPe 2.05: d4k14a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k14A (A:)
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
ienakkievefdkgqrtdkygrglayiyadgkmlnealvrqglakvayvykpnntheqhl
rkseaqakkeklniws