PDB entry 4k0o

View 4k0o on RCSB PDB site
Description: F17b-G lectin domain with bound GlcNAc(beta1-3)Gal
Class: sugar binding protein
Keywords: immunoglobulin-like fold, lectin, carbohydrate receptor, acetylation of lysine side chain, cellular envelope, SUGAR BINDING PROTEIN
Deposited on 2013-04-04, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F17b-G fimbrial adhesin
    Species: Escherichia coli [TaxId:562]
    Gene: f17bG, F17G
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4k0oa_
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4k0oA (A:)
    vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4k0oA (A:)
    vvsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrigggfcvgldgkv
    dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnylstqgl
    svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlnd