PDB entry 4k06

View 4k06 on RCSB PDB site
Description: Crystal structure of MTX-II from Bothrops brazili venom complexed with polyethylene glycol
Class: toxin
Keywords: Phospholipase A2, TOXIN
Deposited on 2013-04-03, released 2013-11-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mtx-II
    Species: Bothrops brazili [TaxId:157546]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K06 (0-119)
    Domains in SCOPe 2.08: d4k06a_
  • Chain 'B':
    Compound: mtx-II
    Species: Bothrops brazili [TaxId:157546]
    Database cross-references and differences (RAF-indexed):
    • PDB 4K06 (0-120)
    Domains in SCOPe 2.08: d4k06b_
  • Heterogens: PGE, SO4, PE4, 7PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k06A (A:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4k06B (B:)
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcdpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadp
c