PDB entry 4jzq

View 4jzq on RCSB PDB site
Description: Crystal structure of human CLIC1 C24D mutant
Class: transport protein
Keywords: CLIC, Glutathione-S-Transferase fold, Chloride ion channel, transport protein
Deposited on 2013-04-03, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, CLIC1 G6 NCC27, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299 (Start-242)
      • engineered mutation (25)
    Domains in SCOPe 2.07: d4jzqa1, d4jzqa2
  • Chain 'B':
    Compound: chloride intracellular channel protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CLIC1, CLIC1 G6 NCC27, G6, NCC27
    Database cross-references and differences (RAF-indexed):
    • Uniprot O00299
      • engineered mutation (25)
    Domains in SCOPe 2.07: d4jzqb1, d4jzqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jzqA (A:)
    gsmaeeqpqvelfvkagsdgakigndpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqkl
    cpggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayi
    knsnpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladc
    nllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvak
    alk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jzqA (A:)
    qpqvelfvkagsdgakigndpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggql
    pfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpa
    lndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpkl
    hivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvakalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jzqB (B:)
    gsmaeeqpqvelfvkagsdgakigndpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqkl
    cpggqlpfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayi
    knsnpalndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladc
    nllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvak
    alk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jzqB (B:)
    qpqvelfvkagsdgakigndpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggql
    pfllygtevhtdtnkieefleavlcpprypklaalnpesntagldifakfsayiknsnpa
    lndnlekgllkalkvldnyltsplpeevdetsaedegvsqrkfldgneltladcnllpkl
    hivqvvckkyrgftipeafrgvhrylsnayareefastcpddeeielayeqvak