PDB entry 4jzj

View 4jzj on RCSB PDB site
Description: Crystal Structure of Receptor-Fab Complex
Class: cytokine receptor/immune system
Keywords: receptor-fab complex, CYTOKINE RECEPTOR-IMMUNE SYSTEM complex
Deposited on 2013-04-03, released 2014-04-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JZJ (0-220)
  • Chain 'B':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JZJ (0-End)
    Domains in SCOPe 2.07: d4jzjb1, d4jzjb2
  • Chain 'C':
    Compound: Interleukin-3 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL3RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26951
      • see remark 999 (124)
  • Chain 'D':
    Compound: Interleukin-3 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL3RA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26951
      • see remark 999 (124)
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JZJ (0-220)
  • Chain 'L':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JZJ (0-End)
    Domains in SCOPe 2.07: d4jzjl1, d4jzjl2
  • Heterogens: NAG, FUL, BMA, MAN, FUC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jzjB (B:)
    divmtqspdslavslgeratincessqsllnsgnqknyltwyqqkpgqppkpliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndysypytfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jzjB (B:)
    divmtqspdslavslgeratincessqsllnsgnqknyltwyqqkpgqppkpliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndysypytfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jzjL (L:)
    divmtqspdslavslgeratincessqsllnsgnqknyltwyqqkpgqppkpliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndysypytfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jzjL (L:)
    divmtqspdslavslgeratincessqsllnsgnqknyltwyqqkpgqppkpliywastr
    esgvpdrfsgsgsgtdftltisslqaedvavyycqndysypytfgqgtkleikrtvaaps
    vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
    lsstltlskadyekhkvyacevthqglsspvtksfnrge