PDB entry 4jz7

View 4jz7 on RCSB PDB site
Description: Carbamate kinase from Giardia lamblia bound to AMP-PNP
Class: transferase
Keywords: modified Rossmann fold, ATP carbamate phosphotransferase, ADP, Mg2+, carbamoyl phosphate, TRANSFERASE
Deposited on 2013-04-02, released 2013-06-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.217
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbamate kinase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_16453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jz7a_
  • Chain 'B':
    Compound: carbamate kinase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_16453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jz7b_
  • Chain 'C':
    Compound: carbamate kinase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_16453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jz7c_
  • Chain 'D':
    Compound: carbamate kinase
    Species: Giardia lamblia [TaxId:184922]
    Gene: GL50803_16453
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jz7d_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jz7A (A:)
    gmsagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqv
    gaiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlv
    dpkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygv
    iktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvl
    nacinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitsls
    tavdalngkcgtriikd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz7A (A:)
    msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
    aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
    pkdqaftnptkpvvvpsprpleiveygviktlidnnvlvictngggipckrenkvisgvd
    avidkdlatsllaktlnsdylmiltdvlnacinykkpderkleeiklseilalekdghfa
    agsmgpkvraaieftqatgkmsiitslstavdalngkcgtriikd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jz7B (B:)
    gmsagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqv
    gaiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlv
    dpkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygv
    iktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvl
    nacinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitsls
    tavdalngkcgtriikd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz7B (B:)
    msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
    aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
    pkdqaftnptkpvvvpsprpleiveygviktlidnnvlvictngggipckrenkvisgvd
    avidkdlatsllaktlnsdylmiltdvlnacinykkpderkleeiklseilalekdghfa
    agsmgpkvraaieftqatgkmsiitslstavdalngkcgtriikd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jz7C (C:)
    gmsagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqv
    gaiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlv
    dpkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygv
    iktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvl
    nacinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitsls
    tavdalngkcgtriikd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz7C (C:)
    msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
    aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
    pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi
    ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln
    acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst
    avdalngkcgtriikd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jz7D (D:)
    gmsagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqv
    gaiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlv
    dpkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygv
    iktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvl
    nacinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitsls
    tavdalngkcgtriikd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz7D (D:)
    msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg
    aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd
    pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi
    ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln
    acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst
    avdalngkcgtriikd