PDB entry 4jz2

View 4jz2 on RCSB PDB site
Description: Crystal structure of Co ion substituted SOD2 from Clostridium difficile
Class: oxidoreductase
Keywords: Rossmann Fold, superoxide dismutase, METAL ION Binding, cytosol, OXIDOREDUCTASE
Deposited on 2013-04-02, released 2014-04-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.182
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Clostridium difficile [TaxId:272563]
    Gene: sodA, CD630_16310
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4jz2a1, d4jz2a2
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jz2A (A:)
    pennkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcel
    lqnldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqe
    fqksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnr
    rneyidnwfnvvnwngalenyknlksqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jz2A (A:)
    nnkfkvkplpyaydalepyidketmklhhdkhyqayvdklnaalekypelynyslcellq
    nldslpkdiattvrnnaggaynhkfffdimtpektipseslkeaidrdfgsfekfkqefq
    ksaldvfgsgwawlvatkdgklsimttpnqdspvsknltpiigldvwehayylkyqnrrn
    eyidnwfnvvnwngalenyknl