PDB entry 4jys

View 4jys on RCSB PDB site
Description: Crystal structure of FKBP25 from Plasmodium Vivax
Class: isomerase
Keywords: Plasmodium Vivax, Non-Canonical, FKBP, FKBP25, ISOMERASE
Deposited on 2013-04-01, released 2014-02-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2014-02-12, with a file datestamp of 2014-02-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_122487
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Plasmodium vivax [TaxId:126793]
    Gene: PVX_122487
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4jysb_
  • Heterogens: IMD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4jysB (B:)
kyksdkpyvktesgilykdlidgegdpieegdivyihyqgkttndfriihstfnsiippk
iragqydqkhiraiyeivigmkkhtrrqcvvpphlaypnhfpsqpllyeidvvkvvkkds
qgktfiekveqkidqirs

    Sequence, based on observed residues (ATOM records): (download) 
    >4jysB (B:)
dkpyvktesgilykdlidgegdpieegdivyihyqgkttndfriihstfnsiippkirag
qydqkhiraiyeivigmkkhtrrqcvvpphlaypnhfpsqpllyeidvvkvvkk