PDB entry 4jyk

View 4jyk on RCSB PDB site
Description: Structure of E. coli Transcriptional Regulator RutR with bound uracil
Class: transcription regulator
Keywords: Structural Genomics, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Helix-turn-Helix, Transcriptional Regulator, TRANSCRIPTION REGULATOR
Deposited on 2013-03-29, released 2013-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli [TaxId:83333]
    Gene: b1013, JW0998, rutR, ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jyka1, d4jyka2
  • Chain 'B':
    Compound: HTH-type transcriptional regulator rutR
    Species: Escherichia coli [TaxId:83333]
    Gene: b1013, JW0998, rutR, ycdC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jykb1, d4jykb2
  • Heterogens: SO4, URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jykA (A:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jykA (A:)
    rsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlr
    qildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdelt
    gdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrde
    vffnqtvenvqriiiegirpr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jykB (B:)
    mtqgavkttgkrsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfp
    skealyiavlrqildiwlaplkafredfaplaaikeyirlklevsrdypqasrlfcmeml
    agapllmdeltgdlkalideksaliagwvksgklapidpqhlifmiwastqhyadfapqv
    eavtgatlrdevffnqtvenvqriiiegirpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jykB (B:)
    sakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqildi
    wlaplkafredfaplaaikeyirlklevsrdypqasrlfcmemlagapllmdeltgdlka
    lideksaliagwvksgklapidpqhlifmiwastqhyadfapqveavtgatlrdevffnq
    tvenvqriiiegirpr