PDB entry 4jx7

View 4jx7 on RCSB PDB site
Description: Crystal structure of Pim1 kinase in complex with inhibitor 2-[(trans-4-aminocyclohexyl)amino]-4-{[3-(trifluoromethyl)phenyl]amino}pyrido[4,3-d]pyrimidin-5(6H)-one
Class: transferase/transferase inhibitor
Keywords: Serine/threonine-protein kinases, ATP binding, Phosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-27, released 2013-08-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase pim-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jx7a_
  • Chain 'B':
    Compound: PIM1 consensus peptide
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4JX7
  • Heterogens: 1N6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jx7A (A:)
    mllskinslahlraapcndlhatklapgkekeplesqyqvgpllgsggfgsvysgirvsd
    nlpvaikhvekdrisdwgelpngtrvpmevvllkkvssgfsgvirlldwferpdsfvlil
    erpepvqdlfdfitergalqeelarsffwqvleavrhchncgvlhrdikdenilidlnrg
    elklidfgsgallkdtvytdfdgtrvysppewiryhryhgrsaavwslgillydmvcgdi
    pfehdeeiirgqvffrqrvssecqhlirwclalrpsdrptfeeiqnhpwmqdvllpqeta
    eihlhslspgpskaaalehhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx7A (A:)
    plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
    lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
    eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
    iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
    lrpsdrptfeeiqnhpwmqdvllpqetaeihlhs
    

  • Chain 'B':
    No sequence available.