PDB entry 4jx1

View 4jx1 on RCSB PDB site
Description: Crystal structure of reduced Cytochrome P450cam-putidaredoxin complex bound to camphor and 5-exo-hydroxycamphor
Class: oxidoreductase/electron transport
Keywords: reduced P450cam-Pdx complex, redox partners, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2013-03-27, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jx1a_
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jx1b_
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (Start-112)
      • engineered mutation (25)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4jx1c_
  • Chain 'D':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (Start-112)
      • engineered mutation (25)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4jx1d_
  • Chain 'E':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jx1e_
  • Chain 'F':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jx1f_
  • Chain 'G':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (Start-112)
      • engineered mutation (25)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4jx1g_
  • Chain 'H':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00259 (Start-112)
      • engineered mutation (25)
      • engineered mutation (79)
    Domains in SCOPe 2.07: d4jx1h_
  • Heterogens: HEM, CAM, CAH, CA, FES, 1N0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jx1A (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1A (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jx1B (B:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1B (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jx1C (C:)
    hhhhhhmskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvn
    eaftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1C (C:)
    skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jx1D (D:)
    hhhhhhmskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvn
    eaftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1D (D:)
    skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4jx1E (E:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1E (E:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jx1F (F:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1F (F:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
    riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
    smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
    ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
    vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
    tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jx1G (G:)
    hhhhhhmskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvn
    eaftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1G (G:)
    skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jx1H (H:)
    hhhhhhmskvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvn
    eaftdkvpaanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jx1H (H:)
    skvvyvshdgtrreldvacgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw