PDB entry 4jwx

View 4jwx on RCSB PDB site
Description: GluN2A ligand-binding core in complex with propyl-NHP5G
Class: unknown function
Keywords: bilobed structure, UNKNOWN FUNCTION
Deposited on 2013-03-27, released 2013-05-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.162
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GluN2A
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JWX (0-279)
    Domains in SCOPe 2.06: d4jwxa_
  • Heterogens: 1N4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jwxA (A:)
    nhlsivtleeapfvivedidpltetcvrntvpcrkfvkinnstnegmnvkkcckgfcidi
    lkklsrtvkftydlylvtngkhgkkvnnvwngmigevvyqravmavgsltineersevvd
    fsvpfvetgisvmvsrgtqvtglsdkkfqrphdysppfrfgtvpngsternirnnypymh
    qymtrfnqrgvedalvslktgkldafiydaavlnykagrdegcklvtigsgyifattgyg
    ialqkgspwkrqidlallqfvgdgemeeletlwltgicha