PDB entry 4jws

View 4jws on RCSB PDB site
Description: Crystal structure of Cytochrome P450cam-putidaredoxin complex
Class: oxidoreductase/electron transport
Keywords: P450cam-Pdx complex, redox partners, OXIDOREDUCTASE-ELECTRON TRANSPORT complex
Deposited on 2013-03-27, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.178
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jwsa_
  • Chain 'B':
    Compound: Camphor 5-monooxygenase
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMC, CYP101
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00183 (Start-414)
      • engineered mutation (58)
      • engineered mutation (85)
      • engineered mutation (136)
      • engineered mutation (285)
      • engineered mutation (334)
      • engineered mutation (344)
    Domains in SCOPe 2.07: d4jwsb_
  • Chain 'C':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jwsc_
  • Chain 'D':
    Compound: putidaredoxin
    Species: Pseudomonas putida [TaxId:303]
    Gene: CAMB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jwsd_
  • Heterogens: HEM, CA, 1N0, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jwsA (A:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jwsA (A:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfiprsmdppeqrqfralanqvvgmpvvdklenriqelasslie
    slrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrgsmtfaeakealyd
    ylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsfsme
    flakspehrqelierperipaaseellrrfslvadgriltsdyefhgvqlkkgdqillpq
    mlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiivtlkewltripdfs
    iapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jwsB (B:)
    mttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsn
    gghwiatrgqlireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvv
    gmpvvdklenriqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlky
    ltdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeak
    rmcglllvggldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgr
    iltsdyefhgvqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclg
    qhlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jwsB (B:)
    nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
    lireayedyrhfssespfipresmdppeqrqfralanqvvgmpvvdklenriqelassli
    eslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakea
    lydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsf
    smeflakspehrqelierperipaaseellrrfslvadgriltsdyefhgvqlkkgdqil
    lpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiivtlkewltrip
    dfsiapgaqiqhksgivsgvqalplvwdpattkav
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jwsC (C:)
    hhhhhhskvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvne
    aftdkvpaanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jwsC (C:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jwsD (D:)
    hhhhhhskvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvne
    aftdkvpaanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jwsD (D:)
    skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv
    paanereigmlecvtaelkpnsrlccqiimtpeldgivvdvpdrqw