PDB entry 4jwl

View 4jwl on RCSB PDB site
Description: Complexe of ARNO Sec7 domain with the protein-protein interaction inhibitor N-(4-hydroxy-2,6-dimethylphenyl)benzenesulfonamide at pH7.5
Class: signaling protein/inhibitor
Keywords: SIGNALING PROTEIN, ARF1, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2013-03-27, released 2013-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytohesin-2
    Species: Homo sapiens [TaxId:9606]
    Gene: CYTH2, ARNO, PSCD2, PSCD2L
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99418 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d4jwla1, d4jwla2
  • Heterogens: HRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jwlA (A:)
    mgsshhhhhhssglvprgshmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpe
    eiarflykgeglnktaigdylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlp
    geaqkidrmmeafaqryclcnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfv
    amnrgineggdlpeellrnlydsirnepfkipeddgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jwlA (A:)
    hmsktlqrnrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigd
    ylgereelnlavlhafvdlheftdlnlvqalrqflwsfrlpgeaqkidrmmeafaqrycl
    cnpgvfqstdtcyvlsfavimlntslhnpnvrdkpglerfvamnrgineggdlpeellrn
    lydsirnepfkipe