PDB entry 4jvp

View 4jvp on RCSB PDB site
Description: Three dimensional structure of broadly neutralizing anti - Hepatitis C virus (HCV) glycoprotein E2 alpaca nanobody D03
Class: immune system
Keywords: Heavy-chain antibody, nanobody, Immunoglobulin fold, Antibody, IMMUNE SYSTEM
Deposited on 2013-03-26, released 2013-04-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.183
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-HCV E2 alpaca nanobody D03
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JVP
    Domains in SCOPe 2.05: d4jvpa_
  • Chain 'B':
    Compound: Anti-HCV E2 alpaca nanobody D03
    Species: VICUGNA PACOS [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JVP
    Domains in SCOPe 2.05: d4jvpb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jvpA (A:)
    maevqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggt
    yyadsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswg
    qgtqvtvssaaalehhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvpA (A:)
    evqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggtyy
    adsvksrftmsrdnkntvylqmnslkpedtavyycaadkglcswlraggkvtfgswgqgt
    qvtvssaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jvpB (B:)
    maevqlqasggglvqpggslrlsctasgftddyyaigwfrqapgkeregvscitnfdggt
    yyadsvksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlraggkvtfgswg
    qgtqvtvssaaalehhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvpB (B:)
    qlqasggglvqpggslrlsctagftddyyaigwfrqapgkeregvscitnfdggtyyads
    vksrftmsrdnakntvylqmnslkpedtavyycaadkglcswlrakvtfgswgqgtqvtv
    ssaaale