PDB entry 4jve

View 4jve on RCSB PDB site
Description: Co-crystal structure of MDM2 with inhibitor (2R,3E)-2-[(2S,3R,6S)-2,3-bis(4-chlorophenyl)-6-(4-fluorobenzyl)-5-oxomorpholin-4-yl]pent-3-enoic acid
Class: ligase/ligase inhibitor
Keywords: p53, protein-protein interaction, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-03-25, released 2013-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.268
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jvea_
  • Heterogens: 1MQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jveA (A:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlfgvpsfsvkehrkiytmiyrnlvvvngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jveA (A:)
    qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
    sndllgdlgvpsfsvkehrkiytmiyrnlvvv