PDB entry 4jve

View 4jve on RCSB PDB site
Description: Co-crystal structure of MDM2 with inhibitor (2R,3E)-2-[(2S,3R,6S)-2,3-bis(4-chlorophenyl)-6-(4-fluorobenzyl)-5-oxomorpholin-4-yl]pent-3-enoic acid
Class: ligase/ligase inhibitor
Keywords: p53, protein-protein interaction, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-03-25, released 2013-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-06-05, with a file datestamp of 2013-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.268
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Mdm2
  Species: Homo sapiens [TaxId:9606]
  Gene: MDM2
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00987 (0-End)
  Domains in SCOPe 2.08: d4jvea_
• Heterogens: 1MQ, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4jveA (A:)
  qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
  sndllgdlfgvpsfsvkehrkiytmiyrnlvvvngs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4jveA (A:)
  qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivyc
  sndllgdlgvpsfsvkehrkiytmiyrnlvvv