PDB entry 4jva

View 4jva on RCSB PDB site
Description: Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP analog
Class: transferase/transferase inhibitor
Keywords: cAMP-dependent protein kinase, cyclic nucleotide analogs, isoform selectivity, fluorescence anisotropy, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-25, released 2013-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase type II-beta regulatory subunit
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Prkar2b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4jvaa1, d4jvaa2
  • Heterogens: 1OR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jvaA (A:)
    svcaeaynpdeeeddaesriihpktddqrnrlqeackdillfknldpeqmsqvldamfek
    lvkegehvidqgddgdnfyvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpra
    atitatspgalwgldrvtfrriivknnakkrkmyesfieslpflkslevserlkvvdvig
    tkvyndgeqiiaqgdsadsffivesgevritmkrkgksdieengaveiarclrgqyfgel
    alvtnkpraasahaigtvkclamdvqaferllgpcmeimkrniatyeeqlvalfgtnmdi
    vepta
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jvaA (A:)
    aesriihpktddqrnrlqeackdillfknldpeqmsqvldamfeklvkegehvidqgddg
    dnfyvidrgtfdiyvkcdgvgrcvgnydnrgsfgelalmyntpraatitatspgalwgld
    rvtfrriivknnakkrkmyesfieslpflkslevserlkvvdvigtkvyndgeqiiaqgd
    sadsffivesgevritmkrkgkaveiarclrgqyfgelalvtnkpraasahaigtvkcla
    mdvqaferllgpcmeimkrniaty