PDB entry 4juj

View 4juj on RCSB PDB site
Description: Crystal structure of 1918 pandemic influenza virus hemagglutinin mutnat D225G complexed with human receptor analogue LSTc
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-03-25, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 3.01 Å
R-factor: 0.204
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
    Domains in SCOPe 2.07: d4juja1, d4juja2
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jujb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
    Domains in SCOPe 2.07: d4jujc1, d4jujc2
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jujd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WFX3 (0-321)
      • engineered mutation (221)
      • expression tag (322-323)
    Domains in SCOPe 2.07: d4juje1, d4juje2
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:59375]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jujf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jujA (A:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jujB (B:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jujC (C:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jujD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jujD (D:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyse
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jujE (E:)
    dticigyhannstdtvdtvleknvtvthsvnlledshngklcklkgiaplqlgkcniagw
    llgnpecdllltasswsyivetsnsengtcypgdfidyeelreqlssvssfekfeifpkt
    sswpnhettkgvtaacsyagassfyrnllwltkkgssypklsksyvnnkgkevlvlwgvh
    hpptgtdqqslyqnadayvsvgsskynrrftpeiaarpkvrgqagrmnyywtllepgdti
    tfeatgnliapwyafalnrgsgsgiitsdapvhdcntkcqtphgainsslpfqnihpvti
    gecpkyvrstklrmatglrnipar
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jujF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkyseesklnr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jujF (F:)
    glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
    tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
    kvksqlknnakeigngcfefyhkcddacmesvrngtydypkysee