PDB entry 4jua

View 4jua on RCSB PDB site
Description: Crystal Structure of the His70Ser mutant of Benzoylformate Decarboxylase from Pseudomonas putida
Class: lyase
Keywords: Thiamine Diphosphate, LYASE
Deposited on 2013-03-24, released 2013-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-17, with a file datestamp of 2013-04-12.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.132
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Benzoylformate decarboxylase
    Species: Pseudomonas putida [TaxId:303]
    Gene: MDLC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20906
      • engineered mutation (69)
    Domains in SCOPe 2.05: d4juaa1, d4juaa2, d4juaa3
  • Heterogens: CA, TZD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4juaA (A:)
    masvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqa
    srkpafinlssaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlpr
    plvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvs
    ssvrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprc
    pfptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtc
    dpleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfd
    tlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeper
    qviavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpg
    idfralakgygvqalkadnleqlkgslqealsakgpvlievstvspvkhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4juaA (A:)
    asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
    rkpafinlssaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
    lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss
    svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp
    fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd
    pleaarapmgdaivadigamasalanlveessrqlptaapepakvdqdagrlhpetvfdt
    lndmapenaiylneststtaqmwqrlnmrnpgsyyfcaagglgfalpaaigvqlaeperq
    viavigdgsanysisalwtaaqyniptifvimnngtygalrwfagvleaenvpgldvpgi
    dfralakgygvqalkadnleqlkgslqealsakgpvlievstvsp