PDB entry 4ju0

View 4ju0 on RCSB PDB site
Description: Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E complexed with human receptor analogue LSTc
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-03-24, released 2013-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 2.91 Å
R-factor: 0.243
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-321)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0a_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0b_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0c_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0d_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0e_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0f_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-321)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0g_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0h_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0i_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0j_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (0-End)
      • engineered mutation (221)
    Domains in SCOPe 2.07: d4ju0k_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ju0l_
  • Heterogens: NAG, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ju0A (A:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ju0B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0B (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4ju0C (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0C (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ju0D (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4ju0E (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0E (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4ju0F (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0F (F:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ju0G (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4ju0H (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0H (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4ju0I (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0I (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ju0J (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4ju0K (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0K (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4ju0L (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ju0L (L:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky