PDB entry 4jtx

View 4jtx on RCSB PDB site
Description: Crystal structure of 2009 pandemic influenza virus hemagglutinin mutant D225E
Class: viral protein
Keywords: virus attachment, membrane fusion, VIRAL PROTEIN
Deposited on 2013-03-24, released 2013-05-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-08-07, with a file datestamp of 2013-08-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.212
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-322)
      • expression tag (0)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxa_
  • Chain 'B':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxb_
  • Chain 'C':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-322)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxc_
  • Chain 'D':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxd_
  • Chain 'E':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-End)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxe_
  • Chain 'F':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxf_
  • Chain 'G':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-322)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxg_
  • Chain 'H':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxh_
  • Chain 'I':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-322)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxi_
  • Chain 'J':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxj_
  • Chain 'K':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S1 (1-322)
      • engineered mutation (222)
    Domains in SCOPe 2.05: d4jtxk_
  • Chain 'L':
    Compound: Hemagglutinin
    Species: Influenza A virus [TaxId:641501]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jtxl_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jtxA (A:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jtxB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jtxC (C:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxC (C:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jtxD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxD (D:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4jtxE (E:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxE (E:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4jtxF (F:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxF (F:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4jtxG (G:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxG (G:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4jtxH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxH (H:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4jtxI (I:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxI (I:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jtxJ (J:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4jtxK (K:)
    rdtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniag
    wilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpk
    tsswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgi
    hhpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdk
    itfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpit
    igkcpkyvkstklrlatglrnip
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxK (K:)
    dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
    ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
    sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
    hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvreqegrmnyywtlvepgdki
    tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
    gkcpkyvkstklrlatglrnip
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jtxL (L:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
    tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
    kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypkyseea
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jtxL (L:)
    lfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmnt
    qftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlyek
    vrsqlknnakeigngcfefyhkcdntcmesvkngtydypky