PDB entry 4jsc

View 4jsc on RCSB PDB site
Description: The 2.5A crystal structure of humanized Xenopus MDM2 with RO5316533 - a pyrrolidine MDM2 inhibitor
Class: ligase/ligase inhibitor
Keywords: pyrrolidine, ligase-antagonist complex, E3 ubiquitin ligase, p53, nucleus, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-03-22, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.316
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273
      • engineered mutation (30)
      • engineered mutation (72)
      • engineered mutation (75)
    Domains in SCOPe 2.08: d4jsca_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273
      • engineered mutation (30)
      • engineered mutation (72)
      • engineered mutation (75)
    Domains in SCOPe 2.08: d4jscb_
  • Heterogens: 1OY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jscA (A:)
meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg
elfgvqefsvkehrriyamisrnlvs

    Sequence, based on observed residues (ATOM records): (download) 
    >4jscA (A:)
klvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplgel
fgvqefsvkehrriyamisrnlv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4jscB (B:)
meklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplg
elfgvqefsvkehrriyamisrnlvs

    Sequence, based on observed residues (ATOM records): (download) 
    >4jscB (B:)
klvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplgel
fgvqefsvkehrriyamisrnlv