PDB entry 4js9

View 4js9 on RCSB PDB site
Description: Structural Characterization of Inducible Nitric Oxide Synthase Substituted With Mesoheme
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Calmodulin-binding, FAD, FMN, Iron, Metal-binding, NADP, mesoheme
Deposited on 2013-03-22, released 2014-04-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-04-23, with a file datestamp of 2014-04-18.
Experiment type: XRAY
Resolution: 2.78 Å
R-factor: 0.252
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Inosl, Nos2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4js9a_
  • Chain 'B':
    Compound: Nitric oxide synthase, inducible
    Species: Mus musculus [TaxId:10090]
    Gene: Inosl, Nos2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4js9b_
  • Heterogens: MH0, H4B, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4js9A (A:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4js9A (A:)
    qyvriknwgsgeilhdtlhhkatssimnpksltrgprdkptpleellphaiefinqyygs
    fkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqvfd
    arncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyqmp
    tirgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtmehpk
    yewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqrynileev
    grrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqneyrarg
    gcpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkthi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4js9B (B:)
    ldklhvtstrpqyvriknwgsgeilhdtlhhkatsdftcksksclgsimnpksltrgprd
    kptpleellphaiefinqyygsfkeakieehlarleavtkeiettgtyqltldelifatk
    mawrnaprcigriqwsnlqvfdarncstaqemfqhicrhilyatnngnirsaitvfpqrs
    dgkhdfrlwnsqliryagyqmpdgtirgdaatleftqlcidlgwkprygrfdvlplvlqa
    dgqdpevfeippdlvlevtmehpkyewfqelglkwyalpavanmllevgglefpacpfng
    wymgteigvrdfcdtqrynileevgrrmglethtlaslwkdravteinvavlhsfqkqnv
    timdhhtasesfmkhmqneyrarggcpadwiwlvppvsgsitpvfhqemlnyvlspfyyy
    qiepwkthiwq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4js9B (B:)
    yvriknwgsgeilhdtlhhkatsgsimnpksltrgprdkptpleellphaiefinqyygs
    fkeakieehlarleavtkeiettgtyqltldelifatkmawrnaprcigriqwsnlqvfd
    arncstaqemfqhicrhilyatnngnirsaitvfpqrsdgkhdfrlwnsqliryagyqmt
    irgdaatleftqlcidlgwkprygrfdvlplvlqadgqdpevfeippdlvlevtmehpky
    ewfqelglkwyalpavanmllevgglefpacpfngwymgteigvrdfcdtqrynileevg
    rrmglethtlaslwkdravteinvavlhsfqkqnvtimdhhtasesfmkhmqneyrargg
    cpadwiwlvppvsgsitpvfhqemlnyvlspfyyyqiepwkt