PDB entry 4jrv

View 4jrv on RCSB PDB site
Description: Crystal structure of EGFR kinase domain in complex with compound 4c
Class: transferase/transferase inhibitor
Keywords: Transferase, tyrosine kinase domain, ATP-binding domain, autophosphorylation, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-03-22, released 2013-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.194
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jrva_
  • Heterogens: KJV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jrvA (A:)
    gpgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jrvA (A:)
    geapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikeltspkanke
    ildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwc
    vqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhaeggkvpi
    kwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppi
    ctidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgddmddvvdadeylip