PDB entry 4jro

View 4jro on RCSB PDB site
Description: Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (FabG)from Listeria monocytogenes in complex with NADP+
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, CENTER FOR STRUCTURAL GENOMICS OF INFECTIOUS DISEASES, CSGID, short chain dehydrogenase, FabG, beta-ketoacyl-acyl carrier protein reductase, OXIDOREDUCTASE
Deposited on 2013-03-21, released 2013-04-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FabG protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: fabG, lmo1807, NT01LM1948
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jroa_
  • Chain 'B':
    Compound: FabG protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: fabG, lmo1807, NT01LM1948
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jrob_
  • Chain 'C':
    Compound: FabG protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: fabG, lmo1807, NT01LM1948
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jroc_
  • Chain 'D':
    Compound: FabG protein
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Gene: fabG, lmo1807, NT01LM1948
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4jrod_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jroA (A:)
    mhhhhhhssgvdlgtenlyfqsnamtlqgkvavvtggsrgigrdiainlakeganiffny
    ngspeaaeetaklvaehgveveamkanvaiaedvdaffkqaierfgrvdilvnnagitrd
    nllmrmkedewddvininlkgtflctkavsrtmmkqragkiinmasvvglignagqanyv
    askagvigltkttarelaprginvnavapgfittdmtdkldektkeamlaqiplgaygtt
    edianavlflasdaskyitgqtlsvdggmvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jroA (A:)
    mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
    kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
    ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
    navapgfittdmtdkldektkeamlaqiplgaygttedianavlflasdaskyitgqtls
    vdggmvm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4jroB (B:)
    mhhhhhhssgvdlgtenlyfqsnamtlqgkvavvtggsrgigrdiainlakeganiffny
    ngspeaaeetaklvaehgveveamkanvaiaedvdaffkqaierfgrvdilvnnagitrd
    nllmrmkedewddvininlkgtflctkavsrtmmkqragkiinmasvvglignagqanyv
    askagvigltkttarelaprginvnavapgfittdmtdkldektkeamlaqiplgaygtt
    edianavlflasdaskyitgqtlsvdggmvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jroB (B:)
    mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
    kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
    ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
    navapgfittdkeamlaqiplgaygttedianavlflasdaskyitgqtlsvdggmvm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4jroC (C:)
    mhhhhhhssgvdlgtenlyfqsnamtlqgkvavvtggsrgigrdiainlakeganiffny
    ngspeaaeetaklvaehgveveamkanvaiaedvdaffkqaierfgrvdilvnnagitrd
    nllmrmkedewddvininlkgtflctkavsrtmmkqragkiinmasvvglignagqanyv
    askagvigltkttarelaprginvnavapgfittdmtdkldektkeamlaqiplgaygtt
    edianavlflasdaskyitgqtlsvdggmvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jroC (C:)
    mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
    kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
    ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
    navapgfittdmtdkldektkeamlaqiplgaygttedianavlflasdaskyitgqtls
    vdggmvm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4jroD (D:)
    mhhhhhhssgvdlgtenlyfqsnamtlqgkvavvtggsrgigrdiainlakeganiffny
    ngspeaaeetaklvaehgveveamkanvaiaedvdaffkqaierfgrvdilvnnagitrd
    nllmrmkedewddvininlkgtflctkavsrtmmkqragkiinmasvvglignagqanyv
    askagvigltkttarelaprginvnavapgfittdmtdkldektkeamlaqiplgaygtt
    edianavlflasdaskyitgqtlsvdggmvm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jroD (D:)
    mtlqgkvavvtggsrgigrdiainlakeganiffnyngspeaaeetaklvaehgveveam
    kanvaiaedvdaffkqaierfgrvdilvnnagitrdnllmrmkedewddvininlkgtfl
    ctkavsrtmmkqragkiinmasvvglignagqanyvaskagvigltkttarelaprginv
    navapgfittdmtdektkeamlaqiplgaygttedianavlflasdaskyitgqtlsvdg
    gmvm