PDB entry 4jrg

View 4jrg on RCSB PDB site
Description: The 1.9A crystal structure of humanized Xenopus MDM2 with RO5313109 - a pyrrolidine MDM2 inhibitor
Class: ligase/ligase inhibitor
Keywords: protein-inhibitor complex, pyrrolidine, E3 ubiquitin ligase, P53, nucleus, LIGASE-LIGASE INHIBITOR complex
Deposited on 2013-03-21, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.252
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (0-End)
      • engineered mutation (29)
      • engineered mutation (71)
      • engineered mutation (74)
    Domains in SCOPe 2.08: d4jrga_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Xenopus laevis [TaxId:8355]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56273 (0-End)
      • engineered mutation (29)
      • engineered mutation (71)
      • engineered mutation (74)
    Domains in SCOPe 2.08: d4jrgb_
  • Heterogens: I09, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jrgA (A:)
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlvs

    Sequence, based on observed residues (ATOM records): (download) 
    >4jrgA (A:)
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4jrgB (B:)
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlvs

    Sequence, based on observed residues (ATOM records): (download) 
    >4jrgB (B:)
eklvqptplllsllksagaqketftmkevlyhlgqyimakqlydekqqhivhcsndplge
lfgvqefsvkehrriyamisrnlv