PDB entry 4jr9

View 4jr9 on RCSB PDB site
Description: Crystal structure of nitrate/nitrite exchanger NarK
Class: TRANSPORT PROTEIN/Immune System
Keywords: Transporter, Immunoglobulin, Major Facilitator Superfamily, Exchanger, TRANSPORT PROTEIN-Immune System complex
Deposited on 2013-03-21, released 2013-05-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.231
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrite extrusion protein 1
    Species: Escherichia coli [TaxId:83333]
    Gene: b1223, JW1214, narK
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Immunoglobulin Gamma-2a, Heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JR9 (0-216)
  • Chain 'L':
    Compound: Immunoglobulin Kappa, Light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4JR9 (0-210)
    Domains in SCOPe 2.04: d4jr9l1, d4jr9l2
  • Heterogens: GYP, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jr9L (L:)
    dilmtqspsslsvsvgssvtitcqasqnitnyivwyqqkpgqapklliyytstlesgips
    rfsgsgsgrdysftisnlqpedvatyyclqynslltfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkninvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrn