PDB entry 4jqu

View 4jqu on RCSB PDB site
Description: Crystal structure of Ubc7p in complex with the U7BR of Cue1p
Class: ligase/protein binding
Keywords: Ubc7p:U7BR complex, ligase-activator complex, LIGASE-PROTEIN BINDING complex
Deposited on 2013-03-20, released 2013-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 7
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: QRI8, UBC7, Ubc7p, YM9711.12, YMR022W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02159 (5-168)
      • expression tag (0-4)
    Domains in SCOPe 2.08: d4jqua1, d4jqua2
  • Chain 'B':
    Compound: Coupling of ubiquitin conjugation to ER degradation protein 1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: CUE1, Cue1p, KIS4, YM8156.06, YMR264W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38428 (1-53)
      • initiating methionine (0)
  • Heterogens: BTB, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4jquA (A:)
gsaaasktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfna
klefpkdyplsppkltftpsilhpniypngevcisilhspgddpnmyelaeerwspvqsv
ekillsvmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

    Sequence, based on observed residues (ATOM records): (download) 
    >4jquA (A:)
gsaaasktaqkrllkelqqlikdsppgivagpksennifiwdcliqgppdtpyadgvfna
klefpkdyplsppkltftpsilhpniypngevcisilhspyelaeerwspvqsvekills
vmsmlsepniesganidacilwrdnrpeferqvklsilkslgf

  • Chain 'B':
    No sequence available.