PDB entry 4jqi

View 4jqi on RCSB PDB site
Description: Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
Class: signaling protein
Keywords: Arrestin, GPCR, G-protein coupled receptor, signaling, SIGNALING PROTEIN
Deposited on 2013-03-20, released 2013-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.203
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-arrestin-1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: ARRB1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jqia1
  • Chain 'H':
    Compound: Fab30 heavy chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4JQI
  • Chain 'L':
    Compound: Fab30 light chain
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4JQI (0-End)
    Domains in SCOPe 2.07: d4jqil1, d4jqil2
  • Chain 'V':
    Compound: Vasopressin V2 receptor phosphopeptide
    Species:
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, EDO, PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4jqiA (A:)
    gspefpgrlgdkgtrvfkkaspngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerr
    vyvtltcafrygredldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgeha
    ypftfeippnlpcsvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvq
    yaperpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkik
    isvrqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgk
    lkhedtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlm
    hpkpkeepphrevpesetpvdtnlieldtndddivfedfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jqiA (A:)
    trvfkkaspngkltvylgkrdfvdhidlvdpvdgvvlvdpeylkerrvyvtltcafrygr
    edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
    svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyaperpgpqptae
    ttrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisvrqyadiclfn
    taqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkhedtnlasstl
    lrereilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpkpkeepp
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4jqiL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqykyvpvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jqiL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqykyvpvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvsgnsqesvteqdskdstyslsstltlska
    dyekh
    

  • Chain 'V':
    No sequence available.