PDB entry 4jpl

View 4jpl on RCSB PDB site
Description: Crystal structure of Cytochrome C Peroxidase W191G-Gateless in complex with 4-Azaindole
Class: oxidoreductase
Keywords: Model system, ligand binding, free energy calculation, molecular dynamics, OXIDOREDUCTASE
Deposited on 2013-03-19, released 2013-07-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.133
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:285006]
    Gene: CCP1 CCP CPO YKR066C, SCRG_04081
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3LRE1 (0-288)
      • engineered mutation (186-187)
    Domains in SCOPe 2.08: d4jpla_
  • Heterogens: HEM, 4JP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4jplA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegggannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpkyl
    sivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl