PDB entry 4jpb

View 4jpb on RCSB PDB site
Description: The structure of a ternary complex between CheA domains P4 and P5 with CheW and with an unzipped fragment of TM14, a chemoreceptor analog from Thermotoga maritima.
Class: immune system
Keywords: Ternary complex, Transmembrane Signaling Two component system Receptor, Histidine Kinase Adaptor protein, Membrane, IMMUNE SYSTEM
Deposited on 2013-03-19, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: 0.198
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chemotaxis protein chea
    Species: Thermotoga maritima [TaxId:243274]
    Gene: cheA, TM_0702
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermotoga maritima [TaxId:243274]
    Gene: ThemaDRAFT_1422, Tm00014, TM_0014
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: methyl-accepting chemotaxis protein
    Species: Thermotoga maritima [TaxId:243274]
    Gene: ThemaDRAFT_1422, Tm00014, TM_0014
    Database cross-references and differences (RAF-indexed):
  • Chain 'W':
    Compound: chemotaxis protein chew
    Species: Thermotoga maritima [TaxId:243274]
    Gene: cheW, TM_0701
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4jpbw_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4jpbW (W:)
    gshmmktladalkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlr
    griipvvnlakilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsd
    kfgkkskglvktdgrliiyldidkiieeitv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4jpbW (W:)
    lkefevlsfeideqalafdvdniemvieksditpvpksrhfvegvinlrgriipvvnlak
    ilgisfdeqkmksiivartkdvevgflvdrvlgvlritenqldltnvsdkfgkkskglvk
    tdgrliiyldidkiieeitv